Класс кбм 11: Что такое КБМ 0.6 (класс 11) в расчете ОСАГО. Сколько скидка

Содержание

Универсальный культиватор КБМ-11ПСВ

Универсальные культиваторы — новая серия широкозахватных культиваторов КБМ производства «ПК «Ярославич»

Узнать подробности приобретения КБМ-11-4П на выгодных условиях…

Назначение

Применяются для ранневесенней предпосевной обработки почвы, осенней культивации по зяби и закрытия влаги на больших площадях. Не забиваются и стабильно держат глубину обработки на полях с растительными остатками и сорной растительностью.

Видео «Универсальные культиваторы в работе» —  

Преимущества

Расстановка рабочих органов в 4 ряда

Расстановка рабочих органов в 4 ряда обеспечивает 150% сплошное перекрытие при обработке, даже с учетом изнашивания стрельчатых лап в процессе культивации. Гарантировано полное подрезание сорной растительности.

Высокая пружинная стойка собственного производства

Усиленная S-образная пружинная стойка сечением 45х12 мм высотой 520 мм установленная в 4 ряда в сочетании со стрельчатой лапой шириной 215 мм гарантируют оптимальное и очень качественное мелкое рыхление на глубину от 4 до 12 см.

Специальная пружинная сталь.

Проходит термическую обработку и закалку.

Не забивается и стабильно держит глубину обработки.

Стрельчатая лапа собственного производства

Устанавливается стрельчатая лапа шириной 215 мм, гарантирующая сплошное перекрытие поверхности поля и 100% подрезание сорной растительности.

Ширина лапы гарантирует взаимное перекрытие между рядами рабочих органов от 35 до 45 мм.

Незабиваемость

Высокие пружинные стойки, установленные в 4 ряда на расстоянии 680 — 700 мм друг от друга (больше чем у предпосевного культиватора) исключают забивание культиватора растительными и пожнивными остатками.

Опорные колеса

Одинарные или сдвоенные опорные колеса служат для регулировки и поддержания глубины обработки.

Облегчение конструкции

В конструкции исключены модульные рамки, стойки закреплены непосредственно на раму культиватора. Это позволило уменьшить массу конструкции и, соответственно, облегчить работу трактору.

Регулируемая сцепная петля (*опция, устанавливается за отдельную плату)

Позволяет агрегатировать технику с тракторами различных производителей, с разными по высоте прицепными устройствами.

Следорыхлитель (*опция, устанавливается за отдельную плату)

Предназначен для рыхления уплотненной почвы по следу трактора одновременно с выполнением необходимых агротехнических операций.

Ширина стрельчатой лапы — 250 мм.

 

Регулируемые уловители

Устанавливаются на культиваторы КБМ шириной захвата от 7,2 до 15 метров для фиксации боковых крыльев

Световая сигнализация (*опция, устанавливается за отдельную плату)

На центральную раму устанавливается световая сигнализация, дублирующая световые огни трактора.

Система складывания

Удобная система складывания позволяет быстро перевести культиватор из рабочего в транспортное состояние в любых условиях, в т.ч. в полевых. Габариты в транспортном состоянии позволяют легко перевозить культиватор между полями и по дорогам общего пользования.

ДОРОЖНЫЙ ПРОСВЕТ — 300 мм

 

Испытания

Каждый культиватор перед отгрузкой клиенту проходит обязательные заводские испытания, это гарантирует его надежность и работоспособность.

 

Агротехника:

  • Стрельчатая лапа собственного производства шириной 215 мм гарантирует 150% перекрытие и подрезание сорной растительности. Благодаря ширине лапы перекрытие сохраняется даже при изнашивании ее краев в процессе работы
  • Высокая производительность — до 13,2 га/ч. благодаря большой ширине захвата
  • Отсутствие глыб и гребней
  • Подповерхностное уплотнение почвы на глубине посева
  • Эффективное выравнивание поверхности поля
  • Создание благоприятных условий для быстрых всходов, появления вторичных корней и кущения
  • Обеспечивается оптимальный тепло-влаго-воздушный режим
  • Возможность окончания весенне-полевых работ на 1–2 недели раньше

Универсальные культиваторы КБМ обеспечивают комплексную предпосевную подготовку почвы к посеву за 1 проход:

  • культивация
  • рыхление
  • выравнивание
  • предпосевное прикатывание
  • создание подповерхностного уплотненного ложа для семян.

Гарантировано повышение производительности труда, а так же снижение энерго и ресурсозатрат на предпосевную обработку.

Универсальные культиваторы состоят из рамы и сменного заднего модуля

Варианты комплектации культиватора

 

Схема расположения рабочих органов

Комплектация 1 — КБМ-11-4П-1К-ВС

64 стойки с подпружинником в 4 ряда высотой 520 мм, сечение стойки 45х12 мм, стрельчатая лапа шириной 215 мм, одинарный каток, 10 опорных колес.

Назначение

Высокие стойки со стрельчатыми лапами рыхлят почву и подрезают сорную растительность.

Роторный прутковый каток служит для выравнивания поверхности поля после рыхлящих рабочих органов, разрушения почвенных комков и подповерхностного прикатывания на глубине посева, что позволяет сохранить влагу. Комки почвы раздавливаются прутками катка или дробятся, попадая внутрь катка. Диаметр катка подобран путем сложных математических расчетов и проверен на практике. Он исключает проскальзывание прутков катка по комкам почвы и образование почвенного вала перед собой. Прикатывает поверхность поля, покрывая его мульчирующим слоем, который обеспечивает оптимальный тепло-влаго-воздушный режим. Все это способствует более ранним всходам и образованию вторичных корней.

 

 

Схема расположения рабочих органов

Комплектация 2 — КБМ-11-4П-Г1К-ВС

64 стойки с подпружинником в 4 ряда высотой 520 мм, сечение стойки 45х12 мм, стрельчатая лапа шириной 215 мм, планочно-зубовый выравниватель, одинарный каток, 10 опорных колес.

Назначение

В дополнение в роторной бороне (катку) планочно-зубовый выравниватель выравнивает поверхность поля и устраняет комковатость. Применяется при небольшом количестве сорной растительности.

 

 

Схема расположения рабочих органов

Комплектация 3 — КБМ-11-4П-Ш1К-ВС

64 стойки с подпружинником в 4 ряда высотой 520 мм, сечение стойки 45х12 мм, стрельчатая лапа шириной 215 мм, два ряда штригелей, одинарный каток, 10 опорных колес.

Назначение

Штригельная (пружинная) борона рыхлит поверхность почвы, устраняет комковатость, обеспечивая лучший рост и дыхание растений, равномерно распределяет пожнивные остатки (солома) по поверхности поля, создавая таким образом защитное покрытие, способствующее сохранению влаги в почве. Происходит прерывание капиллярности до поверхности почвы и влага не испаряется. Почва не высыхает, водный баланс сохраняется.

Применяется при большем количестве растительных остатков. Благодаря правильной расстановке и правильно подобранному количеству зубцов пружинная борона вычесывает сорную растительность, подрезанную стрельчатыми лапами, не давая ей прорости повторно.

 

 

Четырехрядное расположение рабочих органов на раме культиватора позволяет увеличить продольное и поперечное расстояние между стойками, что предотвращает забивание культиватора растительными остатками в процессе работы. В то же время сохраняется сплошное перекрытие поверхности поля.

S-образная пружинная стойка собственного производства

из специальной закаленной стали. Благодаря высоте в 520 мм не забивается и стабильно работает даже при засоренности растительными и пожнивными остатками.

 

Стрельчатая лапа собственного производства

обеспечивает сплошное перекрытие и 100% подрезание сорной растительности. Работает в условиях засоренности полей растительными и пожнивными остатками.

 

Опорные колеса

предназначены для регулировки глубины обработки и поддержания ее в процессе работы культиватора. Устанавливаются одинарные или сдвоенные опорные колеса в зависимости от влажности почвы.

 

Тип агрегатирования

полуприцепной 

Ширина захвата

11 м 

Глубина обработки

от 4 до 12 см 

Высота стойки

520 мм 

Ширина лапы

215 мм 

Производительность

до 8,5 га/ч*  

Рабочая скорость

8—12 км/ч 

Транспортная скорость

20 км/ч 

Количество пружинных стоек

64 шт. 

Количество стрельчатых лап

64 шт. 

Количество опорных колес

10 шт. 

Количество планочно-зубовых выравнивателей / количество зубьев

6/108 шт.** 

Количество зубьев штригельной бороны

90 шт.** 

Борона роторная, количество катков

Габаритные размеры рабочие (транспортные)

7420х11210х1040 (5285х4830х3275)*** мм 

Давление в шинах опорных колёс

6,2 кгс/см² 

Давление в шинах транспортных колёс

3—3,5 кгс/см² 

Масса, не более

4500 кг 

Агрегатируется с тракторами класса тяги

3—4 (тс) / 220 — 240 л.с. 

Количество обслуживающего персонала

1 чел. 

* При максимальной рабочей скорости ** Наличие или отсутствие данных рабочих органов зависит от комплектации культиватора. *** Указаны максимальные габаритные размеры, для моделей с штригельной бороной.

История | АО Научно-производственная корпорация «КБ Машиностроения»

Ордена Ленина и ордена Трудового Красного Знамени Конструкторское бюро машиностроения (КБМ) создано Постановлением Государственного Комитета Обороны № 1576 от 11 апреля 1942 г. специально для разработки минометного вооружения.

За короткий срок из отдельных разрозненных войной конструкторских групп был организован технически сильный творческий коллектив во главе с Б. И. Шавыриным, развернувший работы по обеспечению нужд фронта в минометном вооружении. В сложных и исключительно трудных условиях военного времени коллектив  КБМ оперативно решает различные вопросы, выявленные в процессе эксплуатации минометов в войсках, осуществляет авторский надзор на заводах и непосредственно на фронте, налаживает непрерывно нарастающее в процессе войны производство минометного вооружения.

Конструкторы КБМ разработали несколько модификаций образцов минометов для различных условий боевого применения, осуществили доработку 82-, 107- и 120-мм минометов.

Творческий результативный труд конструкторского коллектива был высоко оценен партией и правительством. В 1942 году Сталинской премии были удостоены начальник и главный конструктор СКБ Б. И. Шавырин, заместитель главного конструктора Е. А. Ягупов и начальник группы Г. Д. Ширенин. Выдающуюся роль в создании новых образцов минометного вооружения сыграли такие яркие специалисты, как С. В. Гусовский, А. Г. Соколов, С. П. Ванин, П. В. Горячев, В. И. Лукандер, С. Б. Добринский.

В миномётном вооружении — значительная часть миномётов нашей армии (около 80 %), участвовавших в боевых операциях Великой Отечественной войны, были разработаны коллективом под руководством Б. И. Шавырина, сыграв огромную роль в достижении Великой Победы 1945 г.

 

В послевоенный период (1947-56 гг.) разработана система минометного вооружения Советской армии, завершившаяся созданием самого мощного, единственного в мире, миномета — 420-мм самоходной минометной установки «Ока».Сегодня акционерное общество «Научно-производственная корпорация «Конструкторское бюро машиностроения» (АО «НПК «КБМ») — крупный конструкторский и научно-производственный центр, проводящий работы по проектированию, изготовлению, испытанию и в целом комплексной отработке вооружения и военной техники различного направления.

В противотанковом вооружении (ПТРК) — разработаны первый в СССР ПТУРС «Шмель» и самый массовый в мире комплекс «Малютка», впервые применена одноканальная система управления. В 70-80 гг. были созданы первые в мире сверхзвуковая управляемая ракета «Штурм» и на ее основе система вооружения Сухопутных войск с комплексами «Штурм-В» (вертолетным) и «Штурм-С» (самоходным). В 2005 году сдан на вооружение нашей армии всепогодный ПТРК «Хризантема-С», имеющий выдающиеся  технические и боевые характеристики.

АО «НПК «КБМ» является головным разработчиком комплексов управляемого вооружения по четырем направлениям:

    — переносные зенитные ракетные комплексы;
    — противотанковые ракетные комплексы;
    — оперативно-тактические ракетные комплексы;
    — комплексы активной защиты.

В классе ПЗРК КБ машиностроения — мировой лидер и единственное в России предприятие по созданию комплексов этого класса, способных вести эффективную борьбу с низколетящими самолетами и вертолетами. Начатые в 60-х годах на предприятии разработки в этом направлении дали целую серию ПЗРК: «Стрела-2» (первый в СССР), «Стрела -2М», «Стрела-3», «Игла-1», «Игла», «Игла-С». Впервые в мире были решены задачи стрельбы ПЗРК навстречу, защищенности от тепловых помех, залповой стрельбы. Впервые в мире для ПЗРК применено детонирующее топливо. Комплекс «Игла-С» сегодня пользуется большой популярностью и стоит на вооружении не только армии  РФ, но и многих зарубежных армий.

В классе ТРК и ОТРК КБ машиностроения держит лидирующие позиции. Начиная с 70-х годов, на вооружение армии поступили ТРК «Точка», «Точка-У» и ОТРК «Ока» и «Искандер-М». «Точка» стала первым в мире мобильным и высокоточным ТРК. Поступивший на вооружение в 1980 г. ОТРК «Ока» не имел себе равных в мире, но в 1987-89 гг. был уничтожен в соответствии с советско-американским Договором о ликвидации РСМД. В классе ОТРК дальнейшей разработкой стал всемирно известный комплекс «Искандер-М».

По комплексам активной защиты КБМ впервые решило принципиально новую сложнейшую научно-техническую проблему и создало КАЗ «Арена», способный поражать средства, представляющие наибольшую угрозу для объектов бронетанковой техники, что позволяет поднять их выживаемость на поле боя.

Мощный научный, конструкторский и производственный потенциал АО «НПК «КБМ» обеспечивается благодаря высококвалифицированным кадрам, производственному оборудованию, уникальной испытательной базе, стендам, средствам моделирования, хорошо организованной инфраструктуре предприятия. У предприятия мощные, налаженные десятилетиями совместной работы связи со смежниками, серийными заводами. Конструкторские и производственные подразделения (включая испытательный полигон) позволяют оперативно реализовывать замкнутый цикл проектирования: «разработка — изготовление — испытания».

Предприятие активно развивает деловые отношения с ведущими фирмами Европы, Азии, Африки и Латинской Америки, участвует в международных выставках вооружений и военной техники.

 

Олимпиада по ИКТ 2019 Итоги

16 марта 2019 года  состоялась 12-я Олимпиада по информатике и ИКТ в Коломенском институте (филиале) Московского политехнического университета.

Вручение сертификатов участникам и награждение победителей и призеров состоится
на Дне Открытых Дверей 30 марта в 11.00

 Олимпиада проводилась в очной форме в Коломенском институте (филиале) Московского политехнического университета. Организатором Олимпиады являлись Коломенский институт (филиал) Московского политехнического университета,  АО «НПК «КБМ» и МБУ ДПО  «Учебно-методический центр «Коломна».   На торжественном открытии Олимпиады присутствовали представители от Коломенского института (филиала) Московского политехнического университета директор института (филиала) Наталия Александровна Мурзак и заведующий кафедрой АПиИТ Анатолий Михайлович Липатов  представители от АО «НПК «КБМ» начальник бюро отдела подготовки кадров Олег Петрович Тимофеев и представители от МБУ ДПО  «Учебно-методический центр «Коломна» методист Ольга Александровна Прусакова.

Проверить свои знания по информатике и ИКТ в Коломенский институт (филиал) Московского политехнического университета пришли 73 школьника. Свой повышенный уровень знаний проверяли учащиеся гимназии №2 «Квантор», лицея №4, гимназий №9 и №8, средних общеобразовательных школ №№ 4, 12, 14, 15, 16, 18, 21, 24, 30,  а также Сосново-борской, Карасевской средних общеобразовательных школ. Подавляющий процент участников олимпиады составили школьники из гимназии №2 «Квантор».Олимпиада проводится по заданиям, содержащим практические и теоретические задачи.Олимпиадные задания делятся на две части: часть 1-«Тестовая», часть 2-«Программирование». Время, отведенное на выполнение олимпиадных заданий, составляет:-60 мин (1 час) –для заданий части 1-«Тестовая»,-90 мин (1,5 часа) –для заданий части 2 -«Программирование».

В общем итоге занятые в «Олимпиаде 2019» места распределились следующим образом:

В общем зачёте и среди 11 классов:

1 место — Привалов Николай Николаевич – 70,6 баллов (11 класс, гимназия № 9)

2 место — Хлебнов Денис Дмитриевич – 58,9 балла (11 класс, гимназия № 2 «Квантор»)

3 место – Догадин Егор Витальевич – 50,4 балла (МБОУ СОШ № 24)

Среди 10 классов:

1 место – Полонский Кирилл Владимирович – 38,9 балла (10 класс, гимназия № 2 «Квантор»)

2 место — Кулида Антон Михайлович – 29,7 балла (10 класс, гимназия № 2 «Квантор»)

3 место — Лукашик Мария Сергеевна – 26,7 балла (10 класс, Сосновоборская СОШ)

Среди 9 классов:

1 место — Леушин Илья Вячеславович – 58,9 балла (9 класс, гимназия № 2 «Квантор»).

2 место – Козырев Иван Николаевич – 42,9 балла (9 класс, гимназия № 2 «Квантор»).

3 место — Селивёрстов Дмитрий Сергеевич – 25,6 балла (9 класс, гимназия № 2 «Квантор»).

Следует обратить внимание, что у победителей среди 9 классов (1 и 2 места) результаты выше, чем у десятиклассников

Поощрительными призами отмечены:

Колегов Андрей Александрович (11 класс, МБОУ СОШ № 15) – за хорошую подготовку и лучший результат в компьютерной графике 

Горюнов Данил Александрович  (7 класс, гимназия № 2 «Квантор»)  – за лучший результат в своей возрастной группе 

Отдельно хочется отметить самых младших участников Олимпиады, учащихся 7 и 8 классов: Шаверина Василиса Александровна, Горюнов Данил Александрович, Иванова Татьяна Юрьевна, Панюкова Дарья Дмитриевна, Пахомов Роман Данилович, Сущин Артём Евгеньевич, Талалаев Кирилл Алексеевич, Тарасова Екатерина Владимировна, Титова Валерия Эдуардовна, Юсов Яков Андреевич, Пшенникова Диана Николаевна

Вручение сертификатов участникам и награждение победителей и призеров состоится

на Дне Открытых Дверей 30 марта в 11.00

 

           

 Положение об Олимпиаде школьников по Информатике и ИКТ ►

Регламент проведения 12-ой олимпиады школьников по информатике и ИКТ►

Критерии оценки выполнения заданий ►

Что такое КБМ в ОСАГО: таблица 2020

КБМ в ОСАГО: что это такое и как его рассчитать? От чего зависит КБМ ОСАГО для водителя? Как рассчитывается КМБ по ОСАГО для физических лиц?

КБМ в ОСАГО

Государственная Дума еще в 2019 году приняла несколько поправок, повлиявших на ОСАГО. В результате изменился диапазон тарифов, после чего страховщики стали использовать индивидуализированные коэффициенты. Некоторые положения вступили в силу лишь в 2020 году, поэтому вопрос о том, как сейчас рассчитывается коэффициент КБМ в страховании, остается открытым.

Осуществляя расчет стоимости ОСАГО, перейдя по ссылке inguru.ru/kalkulyator_osago/reg_rjazanskaja_oblast/ryazan, абсолютно все страховщики используют коэффициент бонус-малус. Он способен значительно изменять размер страховой премии с учетом персональной истории вождения страхователя.

Как рассчитывается КБМ по ОСАГО для физических лиц?

При определении коэффициента бонус-малус страховыми организациями используется специальная таблица, представленная на официальном сайте РСА. Также учитывается история страховых выплат, характеризующая поведение автолюбителя на дороге. Важным условием вычисления служит завершение срока действия предыдущего полиса. При этом договор страхования должен быть оформлен на весь год, так как на краткосрочные полисы этот коэффициент не распространяется.

        Важно! Значение КБМ в страховом полисе ОСАГО указывается не всегда, так как нет закона, обязывающего страховщиков это делать. Но некоторые организации берут инициативу в свои руки и вписывают значение параметра в раздел «Особые отметки».

Чтобы посчитать КБМ самостоятельно, нужно изначально отталкиваться от класса, присвоенного автомобилисту. Если «автогражданка» оформляется впервые, страхователь получает 3 класс с КБМ равным единице. При наличии страховых выплат а отчетном периоде выбирается строка, соответствующая числу платежей за последний период страхования.

Чтобы стало более понятно, как коэффициент бонус-малус (КБМ) в ОСАГО рассчитывается по таблице в 2020 году с учетом класса водителя, рассмотрим пример: Ивантеев Алексей Николаевич со стажем вождения 7 лет за весь период эксплуатации авто не стал виновником аварии, приведшей к страховым выплатам. Для него отсчет был начат с 3 класса, но за каждый «чистый» год значение повышалось. В итоге Алексей Николаевич получил следующий результат — 10 класс с коэффициентом, равным 0,65. При следующем оформлении «автогражданки» он может рассчитывать на 35% скидку, так как за каждый безаварийный год стоимость полиса снижается на 5%.

Если договор предполагает страхование без ограничений, коэффициент бонус-малус определяется для собственника транспортного средства. В случае с ограниченной страховкой агенты применяют максимальный множитель из всех указанных.

От чего зависит КБМ ОСАГО водителя?

Согласно расшифровке, КБМ в страховке ОСАГО — значение, устанавливаемое за вождение без аварий. Оно зависит от количества страховых возмещений, произведенных по вине водителя. Если страховщик не компенсирует убытки потерпевшей стороне в течение всего срока действия договора, значение бонус-малуса уменьшается на 0,05% в следующем периоде.

С августа 2020 года страховые компании начали учитывать не только историю вождения, но и иные обстоятельства, которые тоже влияют на итоговую цену ОСАГО. Многие из них давно используются при расчете стоимости КАСКО inguru.ru/kalkulyator_kasko, поэтому они не стали для автовладельцев чем-то новым. Речь идет о грубых нарушениях ПДД, наличии телематических устройств, установленных в машине, семейном положении страхователя и т.д. Однако ключевую роль всегда играет безаварийное вождение, которое и регулятор и страховщики готовы поощрять.

 

почему теряется, как самому вернуть

Расскажем для чего нужен КБМ, что такое бонус малус и почему информация о нем может затеряться. Как восстановить самому — варианты действий.

При оформлении ОСАГО многие водители сталкиваются с проблемой отсутствия КБМ, без которого невозможно уменьшить общую стоимость страхового полиса. Восстановление КБМ (если утеряно или не начислялось многие года), даёт возможность водителю получить определённые преимущества — уменьшить цену страхового полиса до 50 процентов за безаварийную езду. Если были столкновения, то данный коэффициент увеличит цену полиса.

Особенности и причины утери

КБМ или коэффициент бонус малус — способ поощрения водителей, не допускающих аварии, в виде скидок к стоимости авто страхования. Если для начинающего водителя он равняется 1 или больше, то у автолюбителя с десятилетним стажем безаварийного вождения составляет 0,5. Т.е. за ОСАГО он платит в 2 раза меньше. В некоторых случаях владельцы не имеют возможности подтвердить право получения скидки, т.к. представители страховой компании не могут найти сведения об КБМ. Существует несколько возможных причин, по которым они теряются:
  • ошибки при добавлении водителя в полис родственниками;
  • при замене водительского удостоверения и смене фамилии сведения обнуляются. Владелец ошибочно приравнивается к новичку;
  • умышленное сокрытие сведений;
  • случайная ошибка, которая может не передать все сведения о владельце машины.

Некоторые страховщики специально не вносят данные об авариях. При переходе в другую «страховую» будет КБМ = 1, даже если несколько лет ездили без происшествий.

Таблица. Расчет коэффициента

Класс КБМ Полученный класс КБМ
Без аварий 1 ДТП 2 аварии 3 ДТП 4 аварии
M 2,45 0 M M M M
0 2,3 1 M M M M
1 1,55 2 M M M M
2 1,4 3 1 M M M
3 1 4 1 M M M
4 0,95 5 2 1 M M
5 0,9 6 3 1 M M
6 0,85 7 4 2 M M
7 0,8 8 4 2 M M
8 0,75 9 5 2 M M
9 0,7 10 5 2 1 M
10 0,65 11 6 3 1 M
11 0,6 12 6 3 1 M
12 0,55 13 6 3 1 M
13 0,5 13 7 3 1 M

Смотреть таблицу следует так. Изначально автолюбителю присваивается 3 класс КБМ = 1. Если аварий за год не было, то на следующий получается 4 класс. И так далее. Если за первый год была 1 авария, то класс присваивается = 1 и КБМ водителя станет 1,55. Т.е. платить за страхование авто придётся больше. Если ездили 10 лет без ДТП и потом совершили за 12 месяцев более 3 столкновений по вашей вине, то повышающий коэффициент станет = 2,45. Каждый автолюбитель может проверить собственный коэффициент, но уясним некоторые особенности, влияющие на изменения этого показателя. Повышению КБМ способствует участие водителя в ДТП. Помимо этого, скидка пропадает, если владелец своевременно не продлевает полис ОСАГО. Не будет бонуса, когда водитель оформил страховку менее года. Максимальная скидка – 50 %. Максимальный коэффициент бонус-малус в страховании машин составляет 2,45.Проверить состояние можно на сайте РСА (www.autoins.ru), предоставив основные документы (паспорт и авто права) и заполнив предложенную форму. При предъявлении необходимых документов и правильном заполнении заявки можете быстро узнать интересующий показатель.

Правила восстановления

Если данные на сайте РСА отличаются от сведений, которыми обладает страховая компания, то проблему можно исправить и вернуть скидку на ОСАГО. Есть несколько способов:

Подать специальное письмо в РСА

В котором сообщить о жалобе относительно неточности в показателях. В заявлении, помимо текста, нужно указать точные данные заявителя и приложить копию водительских прав. Если есть какие-либо документальные доказательства собственной правоты, их также необходимо предоставить в заявлении. Проверка и восстановление через базу РСА не быстрая. Иногда все процедуры занимают до нескольких месяцев, при этом автолюбители фактически не получает никакой гарантии положительного исхода. РСА предлагает пользователям бесплатную горячую линию, по которой можно предварительно выяснить интересующий вопрос. Параллельно можно написать письмо на сайте Центробанка России.

При помощи интернета

Бывают платные и бесплатные сервисы. Главным преимуществом подобных сайтов является скорость их работы. Как уверяют представители, оказывающих платные услуги по возвращению положенной по закону скидки по ОСАГО, они гарантированно выполняют задание в минимальные сроки.

Восстановление КБМ при помощи интернета возможно. Но обращаться нужно к проверенным специалистам с положительными отзывами. Мошенников тоже много.

Нормальные страховые компании с хорошей репутацией зачисляют коэффициент бонус малус и предоставляют скидки. Остерегайтесь страховщиков с плохой репутацией. Обратиться в нормальную контору гораздо проще, чем доказывать свою невиновность и восстанавливать КБМ после недобросовестных страхователей.

Таблица КБМ ОСАГО 2021 по базе РСА

Эта статья пригодится всем, кто хочет сэкономить на ОСАГО и приобрести полис по разумной цене. Коэффициент «Бонус-Малус» — это реальная возможность получить скидку за аккуратное вождение и застраховать машину за меньшие деньги.

Этот коэффициент используют все страховые компании для расчетов по договору. Для каждого водителя он определяется индивидуально. Начинающему автолюбителю присваивается третий класс водителя, которому соответствует коэффициент «Бонус-Малус» равный 1. В дальнейшем КБМ уменьшается, если водитель не становится виновником ДТП, или растет, если наступает страховой случай. В зависимости от него изменяется и стоимость полиса ОСАГО.

Таблица КБМ по базе АИС РСА онлайн — официальный сайт

Важно следить за правильностью расчетов, чтобы не переплачивать за страховку. Нередки случаи, когда страховая компания несвоевременно передает данные о безаварийной езде. Найти ошибку в расчетах не так-то просто, из-за этого невнимательные клиенты покупают более дорогие полисы.

Существует единая база данных для всех водителей, которая находится на сайте РСА. С ее помощью каждый может самостоятельно определить свой КБМ. Для удобства на нашем сайте приведена таблица КБМ ОСАГО 2021 года. Она содержит все возможные варианты и значения коэффициента. Воспользоваться ей несложно, это отнимет всего несколько минут, зато убережет от переплаты.

Таблица КБМ класса водителя — коэффициент «Бонус-Малус»

Для начала найдите в левом столбце свой класс на начало периода страхования. Узнать его можно в своей страховой компании. Далее найдите в соответствующем столбце количество страховых случаев, в которых вы были признаны виновником, и определите свой класс на следующий страховой период. Например, если ранее был присвоен третий класс, за год не было ни одной аварии, то в следующем году вам присвоят четвертый класс. В соответствующей графе вы увидите КБМ на следующий расчетный период (в нашем случае он будет равен 0,95). За каждый год вождения без страховых выплат вы получаете скидку в размере 5%, то есть КБМ снижается на 0,05.

Стоит заметить, что таблица КБМ по базе АИС РСА онлайн на официальном сайте позволяет получить только расчетные данные. Чтобы узнать точную стоимость полиса ОСАГО, воспользуйтесь нашим бесплатным сервисом. Мы поможем узнать точную сумму всего за несколько минут. Просто укажите ФИО водителя, класс, номер и серию удостоверения и нажмите кнопку «Рассчитать». Наш сервис доступен круглосуточно, попробуйте прямо сейчас!

KBM Group поздравляет SAP Test Lab с присвоением статуса DMA

Ричардсон, Техас, 11 июня 2013 г. (GLOBE NEWSWIRE) — Тестовая лаборатория SAP, разработанная группой глобального цифрового маркетинга SAP и KBM Group вышли в финал конкурса DMA Innovation Awards в г. категория «Цифровые технологии». SAP демонстрируется вместе с другими финалистами во время интегрированной Неделя маркетинга в столичном павильоне Нью-Йорка неделя 10 июня.

Test Lab, многоканальный фреймворк для нескольких кампаний, использующий A / B-тестирование в реальном времени и многомерное тестирование для оценки контента на SAP.com и включает аналитику для создания значительных постепенный рост онлайн-спроса SAP и программы поддержки клиентов. Самое главное, он действует как центральный информационная служба для проведения и анализа тестов, а также распространение результатов во всем мире в прозрачной и понятной форме составление отчетов. Таким образом Test Lab ускоряет цикл организационное обучение и обеспечивает быстрые, непрерывные улучшения в маркетинговых результатах. Test Lab институционализирует производительность тестирование, не только улучшая результаты в конкретном маркетинге каналов связи, к которым он обращается, но также создает корпоративная среда для оптимизации производительности.

Победитель премии DMA Innovation Award будет объявлен на DMA ежегодная конференция, 12-17 октября. Премия отмечает «революционные изменения в правилах игры». продукты и решения, которые позволяют маркетологам отказаться от традиционные методы маркетинга и с уверенностью войдите в маркетинговое пространство, в котором доминируют методы, основанные на данных, и определяется быстрое развитие, рост и изменение ».

О SAP
Как лидер рынка корпоративного прикладного программного обеспечения, SAP (NYSE: SAP) помогает компаниям любого размера и отрасли работать лучше.Из из бэк-офиса в зал заседаний, от склада до витрины, от рабочего стола до мобильное устройство — SAP дает возможность людям и организациям работать вместе более эффективно и более эффективно использовать бизнес-идеи чтобы оставаться впереди конкурентов. Приложения и сервисы SAP позволяют более 238000 клиентов работать с прибылью, адаптироваться непрерывно и устойчиво расти. Для получения дополнительной информации посетите www.sap.com.

О компании KBM Group

Группа КБМ помогает компаниям создавать значимые и взаимовыгодные выгодное взаимодействие со своими клиентами благодаря управляемым данными идеи.Мы объединяем данные, сложную аналитику, действенные идеи и маркетинговые технологии для оптимизации многоканальности взаимодействие на протяжении всего жизненного цикла клиента. КБМ Групп маркетинговые услуги мирового уровня включают стратегический маркетинг консалтинг, интеграция данных и управление базами данных, аналитика, цифровые услуги, аутсорсинг, творческие услуги и реагирование Сервисы. Наша материнская компания Wunderman является частью Young & Rubicam Group и член WPP (NASDAQ: WPPGY).

www.kbmg.com

         Прием на  

— Государственная школа КБМ, Мандрелла

1. Общие правила:

1. Проспект и форму приема можно получить в офисе школы во время школьных занятий.
2. Для временного зачисления в класс XI кандидат должен предоставить табель успеваемости класса IX вместе с ксерокопией табеля успеваемости класса X SA1.
3. Прямой прием в классы X и XII отсутствует. Зачисление может быть дано только в случае передачи родителей или переезда дома при наличии документального подтверждения.
4. Школы строго соблюдают все правила и положения Закона RTE.

2. Документы, предъявляемые при приеме:

1. Для класса до I — оригинал свидетельства о рождении и его заверенная фотокопия.
2. Для класса II и выше, оригинальный T.C. заверенную подписями компетентного органа и табель успеваемости с предыдущей академической сессии.
3. 3 копии фотографии паспортного размера.
4. Миграционное свидетельство для студента, прибывающего из других государств.

3. Правило оплаты:

(i) Плата за обучение и проживание оплачиваются двумя равными частями в апреле и октябре. Оплата должна производиться не позднее первой недели апреля и первой недели октября каждого года.
(ii) Все платежи должны быть либо наличными, либо банковским переводом в пользу «KBM Public School, Mandrella», выписанными в Государственном банке Индии, подлежащими оплате в Mandrella.
(iii) В случае несвоевременной уплаты пошлины налагается штраф в размере рупий. 10.00 в день будут взиматься с дневных стипендиатов и рупий.50.00 в день на пансионатах до конца месяца, после чего имя ученика будет вычеркнуто из школьных списков. Новый допуск будет произведен по усмотрению Принципала после выплаты полной задолженности.
(iv) В случае настоящих братьев и сестер скидка в размере 20% будет предоставлена ​​на плату за обучение только младшему. Уступка допустима только для двух братьев и сестер.
(v) Комиссия после внесения депозита не возвращается ни при каких обстоятельствах.
(vi) Сертификат передачи выдается только после уплаты всех взносов.
(vii) Сертификат Bonafide / другой сертификат будет выдан при оплате 25 евро.

Горизонтально-расточно-фрезерный станок с ЧПУ KBM-11EM | KURAKI Co., Ltd.

Компактная машина с высокими техническими характеристиками для ускорения производства с превосходной жесткостью и мобильностью

  • ■ Высокоскоростной горизонтально-расточной станок True Style 5000 об / мин.
  • ■ Box Way! Самая быстрая подача в классе: 944 дюйма / мин (24 м / мин) в режиме Rapid, 472 дюйма / мин (12 м / мин) в режиме резки!
  • ■ Высокая нагрузка на стол 8 800 фунтов! (4000 кг)
КБМ-11ЭМ Стандартные технические характеристики
Ход Перемещение по оси X (продольный стол) мм (дюйм) 1500 (59.06)
Перемещение по оси Y (вертикальный шпиндель) мм (дюйм) 1200 (47,24)
Перемещение по оси Z (пересечение стола) мм (дюйм) 700 (27,56)
Перемещение по оси W (ось шпинделя) мм (дюйм) 350 (13,78)
Расстояние от столешницы до центра шпинделя мм (дюйм) 0 1200 (0 47.24)
Расстояние от центра стола до вершины шпинделя мм (дюйм) 355 1055 (13,98 41,54)
Стол Рабочее место стола мм (дюйм) 950 × 1050 (37,40 × 41,34)
Максимальная грузоподъемность стола кг (фунт) 4000 (8800)
Профиль столешницы мм (дюйм) 22 (0.87) 7T слоты
Таблица автоиндексирования ° 0,001 (каждый индекс 90 °. по расположению штифта)
Головка шпинделя Диаметр расточного шпинделя мм (дюйм) 110 (4.33)
Скорость шпинделя (за каждые 1 мин-1) мин-1 5 5000
Диапазон изменения частоты вращения шпинделя шаг 2
Конус шпинделя BBT50 (BIG-PLUS Двухконтактная шпиндельная система) *
Корм ​​ Ускоренный ход (X ・ Y ・ Z) м (дюйм) / мин 24 (944.88)
(Вт) м (дюйм) / мин 12 (472,44)
Скорость подачи (X ・ Y ・ Z) мм (дюйм) / мин 1 ~ 12000 (0,04 ~ 472,44)
(Вт) м (дюйм) / мин 1 ~ 10000 (0,04 ~ 393,70)
Стол революции мин-1 3.0
Устройство автоматической смены инструмента (ATC) Хвостовик инструмента MAS BT50 (BBT50 BIG-PLUS Двухконтактная шпиндельная система *)
Стяжной болт MAS P50T-1 (45 °)
Вместимость инструмента шт 30
Макс. диаметр инструмента [свободные соседние емкости] мм (дюйм) 125 (4.92) [240 (9,45)]
Макс. длина инструмента мм (дюйм) 400 (15,75)
Макс. вес инструмента кг (фунт) 25 (55)
Выбор инструмента Наугад
Двигатели Двигатель шпинделя кВт (л.с.) AC26 (30) (30 мин) / 22 (25) (продолжение.)
Гидравлический мотор кВт (л.с.) 2,2 (3,0)
Напряжение Мощность (Не вкл. opt) кВА 54
Давление источника давления воздуха МПа 0,5
Расход воздуха от источника давления (Не вкл. opt) нл / мин 1000 (атм.)
Размеры Высота станка мм (дюйм) 3200 (125.98)
Площадь мм (дюйм) 4680 × 4800 (184,25 × 188,98)
Вес машины (вкл. Блок ЧПУ) кг (фунт) 15200 (33440)

* BIG-PLUS — торговая марка, зарегистрированная BIG DAISHOWA SEIKI CO LTD.

Дифференциальные хелперные и эффекторные ответы Lyt-2 + Т-клеток на детерминанты мутанта H-2Kb (Kbm) и проявление влияния тимуса на ответную реакцию CTL против Kbm.

Abstract

Целью данного исследования было оценить и сравнить требования к аллораспознаванию для выявления Lyt-2 + хелперных и эффекторных функций в первичных популяциях Т-клеток. Используя секрецию интерлейкина 2 (IL 2) в качестве меры Т-хелперной (Th) функции и генерацию цитолитических Т-лимфоцитов (CTL) в качестве меры эффекторной функции, в этом исследовании сравнивали ответы Lyt-2 + Т-клеток из диких животных. мышей типа B6 против серии мутантных детерминант H-2Kb. Хотя все детерминанты Kbm стимулировали B6 Lyt-2 + Т-клетки к превращению в цитолитические эффекторные клетки, различные детерминанты Kbm резко различались по своей способности стимулировать Lyt-2 + Т-клетки к функционированию как секретирующие IL 2 клетки-помощники.Например, в отличие от детерминант Kbm1, которые стимулировали как хелперные, так и эффекторные функции, детерминанты Kbm6 только стимулировали B6 Lyt-2 + Т-клетки, чтобы они становились цитолитическими, и не могли стимулировать их к секреции ИЛ 2. Разные функциональные ответы Lyt-2 + T клеток к детерминантам Kbm6 было задокументировано путем определения частоты предшественников, и это не было связано с неспособностью молекулы Kbm6 стимулировать Lyt-2 + Th клетки к секреции IL 2. Скорее, это было специфическое распознавание и ответ Lyt-2 + T клетки к новым мутантным эпитопам на молекуле Kbm6, которая была дефектной, так что анти-Kbm6 Lyt-2 + Т-клетки функционировали только как эффекторы CTL и не функционировали как IL 2-секретирующие Th-клетки.Неспособность Lyt-2 + анти-Kbm6 Т-клеток функционировать как IL 2-секретирующие Th-клетки была характерной чертой всех исследованных популяций Lyt-2 + Т-клеток, в которых ответ на новые мутантные эпитопы можно было отличить от ответа на другие эпитопы, экспрессируемые на молекуле Kbm6. Отсутствие значительного количества Th-клеток против Kbm6 в популяциях Lyt-2 + Т-клеток было исследовано на предмет его функционального воздействия на ответную реакцию CTL против Kbm6. Было обнаружено, что первичные ответы CTL против Kbm6 могут быть легко получены in vitro, но в отличие от ответов на большинство аллоантигенов класса I, которые могут быть опосредованы Lyt-2 + Th-клетками, ответы CTL против Kbm6 строго зависели от собственного Ia- ограниченные клетки L3T4 + Th.Поскольку специфичность рестрикции L3T4 + Th-клеток определяется тимусом, в котором их предшественники дифференцировались, на чувствительность анти-Kbm6 CTL, в отличие от чувствительности к большинству аллоантигенов класса I, в значительной степени влиял фенотип Ia тимуса, в котором отвечающие клетки (РЕФЕРАТ, ОБРЕЗАННЫЙ В 400 СЛОВАХ)

  • Copyright © 1986, Американская ассоциация иммунологов

Ku-связывающий мотив представляет собой консервативный модуль для набора и стимуляции негомологичных белков концевого соединения

Клетки WRN

Иммортализованные hTERT клеточные линии фибробластов ’73–26 ‘(синдром Вернера) 24 и контроль сиблингов дикого типа (’82 –6′) 24 были любезно предоставлены Джуди Кампизи (Buck Institute, CA) и клеточная линия синдрома Вернера AG03141 (ref.38) любезно предоставил Дэвид Киплинг (Кардиффский университет). Ретровирусы, кодирующие белок WRN дикого типа или мутантный белок WRN человека, упаковывали в клетки GP2–293 с использованием универсальной системы упаковки Retro-X (Clontech) в соответствии с инструкциями производителя. Супернатанты GP2–293 использовали для трансдукции 73–26 клеток hTERT в присутствии 4 мкг мл -1 гексадиметринбромида (Polybrene, Sigma) в течение 24 часов. После трех последовательных раундов трансдукции клетки отбирали в 0,5 мг мл -1 G418 в течение 4-6 недель.Полученные культуры подвергали скринингу на экспрессию WRN вестерн-блоттингом с использованием мышиных антител против WRN (Abcam 66601, 1: 500). Все клеточные линии были протестированы, и перед использованием было обнаружено, что они не содержат микоплазм.

Плазмиды

Праймеры, используемые для клонирования и мутагенеза, подробно описаны в дополнительной таблице 1. pET16b-WRN-Exo, кодирующий остатки WRN 1-236 (инвентарный номер UniProt Q14191) и включающий C-концевую октагистидиновую метку, был получен с помощью ПЦР с использованием pEGFP-C3-WRN (подарок Уилла Бора) в качестве шаблона и последующее субклонирование продукта ПЦР в сайты Nco I и Xho I pET16b.Слияние с GST или усиленное слияние с GFP (eGFP) пептиды, кодирующие KBM или XLF-подобные мотивы WRN-nA (последовательность KBM; LETTAAQQRKCPEWMNVQ), WRN-cA (последовательность KBM: TSSAERKRRLPVWKTAK), WRN-XKLGKL последовательность: MRI-A (последовательность KBM: SETKTRVLPSWLTA), MRI-X (последовательность KBM; VLKYVREIFFS), XLF (последовательность KBM; VKRKKPRGLFS) и PAXX (последовательность KBM; FKSKKPAGGVDFDET) были получены путем отжига соответствующих комплементарных олигонуклеотидов B- и . / Xho, I сайтов pGEX6p1 или Bgl II / Sal I сайтов pEGFP-C1, соответственно.Для слитого с GST и слитого с eGFP WRN-cAX остатки 1399–1432 (SSAERKRRLPVWFAKSKKLMDKTKRGGLFS) амплифицировали с помощью ПЦР и субклонировали, как указано выше. GFP-меченный WRN-Exo-cAX был получен с помощью ПЦР-амплификации WRN-Exo (см. Выше) и вставки полученного фрагмента Bgl II в сайт Bam HI pGEX6-cAX. Для создания pEGFP-WRN, кодирующего полноразмерный WRN, стоп-кодон был введен посредством сайт-направленного мутагенеза pEGFP-C3-WRN после S1432, чтобы удалить происходящие из экзогенной плазмиды С-концевые остатки, присутствующие в pEGFP-C3-WRN (см. Выше ) 39 .Альтернативно, для создания pGFP-WRN ΔcAX стоп-кодон был введен в положение S1399. Производные, несущие точечные мутации, были получены путем сайт-направленного мутагенеза с использованием праймеров из дополнительной таблицы 1. pmRFP-Ku70, pmRFP-Ku80 и pmRFP-Ku80 L68R были созданы путем субклонирования из pGFP-Ku70, pGFP-Ku80 и pGFP-Ku80 L68R (ссылка 11). pLXSN, pLXSN-WRN, pLXSN-WRN E84A и pLXSN-WRN K577M были любезными подарками от Джунко Осима 23 .Для дрожжевых двугибридных плазмид фрагменты Nco I / Xho I из pET16b-WRN-Exo и pET16b-WRN-Exo W18G лигировали в сайты Nco I / Sal I pGBKT7. pACT2-Ku80 vWA (кодирующие остатки 1–258) конструировали с использованием фрагмента Xho I из клона 5 pACT, который был выделен из предыдущего скрининга библиотеки комплементарной ДНК человека pACT с использованием APLF в качестве приманки 11 . Таким же образом был субклонирован мутант pACT2-Ku80 vWA L68R .pACT2-Ku70 vWA клонировали с помощью ПЦР-амплификации фрагмента, кодирующего аминокислоты 1-272 Ku70, и вставки в сайты рестрикции Bam HI и Xho I pACT2.

Дрожжевые двухгибридные эксперименты

Для анализа взаимодействия дрожжевые клетки Y190 были котрансформированы указанными плазмидами pACT2 и pGBKT7 и отобраны на планшетах с минимальной средой, лишенными лейцина и триптофана. Трансформированные клетки подвергали скринингу на активацию репортерного гена LacZ с помощью анализов подъема фильтра β-галактозидазы 11 .

Рекомбинантные белки

Strep-tagged WRN, Ku, KuΔC и KuΔC L68R были экспрессированы и очищены из клеток насекомых с использованием системы экспрессии бакуловирусов и очищены с использованием хроматографии с иммобилизованным металл-хелатом и гель-фильтрации 11 . WRN, меченный Strep, очищали с использованием картриджа Affinity Strep-Tactin Superflow Plus (Qiagen) с последующей гель-фильтрацией Superose 6. KuΔC состоит из Ku70 и Ku80ΔC полной длины, лишенных C-концевых остатков 591-732.His-меченный WRN-Exo экспрессировался из pET16b-WRN-Exo в BL21 (DE3) (pLysS) путем индукции 1 мМ IPTG в 0,5 л культур в LB, содержащих 50 мкг мл -1 ампициллина и 30 мкг — 1 хлорамфеникол в течение 16 ч при 16 ° C. Собранные клетки замораживали и впоследствии лизировали в 20 мМ трис-HCl pH 7,5, 0,5 M NaCl, 5% глицерине, 1,4 мМ β-меркаптоэтаноле, 1% Triton X-100, 1 мМ фенилметилсульфонилфториде, 10 мМ имидазоле, pH 8,0. Клетки обрабатывали ультразвуком (3 × 20 с) и экстракты клеток осветляли центрифугированием 12000 г в течение 30 мин.Супернатант инкубировали с 0,5 мл предварительно промытых шариков Ni-агарозы (Qiagen) в течение 20 мин при 4 ° C, и шарики дважды промывали 10 мл промывочного буфера (буфер для лизиса без детергента) перед переносом в колонку с гравитационным потоком. Смолу промывали еще 10 мл промывочного буфера, содержащего 50 мМ имидазола и белков, затем элюировали промывочным буфером, содержащим 250 мМ имидазол. Фракции, содержащие WRN-Exo, объединяли и дополнительно очищали гель-фильтрацией с использованием Superdex 200, уравновешенного 20 мМ трис-HCl, pH 7.5, 0,3 М NaCl, 10% глицерин, 1 мМ ДТТ. Меченные GST KBM экспрессировали, как указано выше, и очищали с использованием аффинной хроматографии на глутатион-сефарозе.

Анализ поляризации флуоресценции

Пептиды, меченные флуоресцеином 100 нМ (Peptide Protein Research), инкубировали при комнатной температуре в течение 10 мин с указанными концентрациями Ku70 / Ku80ΔC (KuΔC) в 20 мМ HEPES pH 7,5, 200 мМ NaCl и 0,5 мМ TCEP. Поляризацию флуоресценции измеряли на микропланшетном ридере POLARstar Omega (BMG Labtech GmbH, Ортенберг, Германия).Для каждой лунки было зарегистрировано пятьдесят вспышек с длиной волны возбуждения 485 нм и одновременное детектирование излучения на длине волны 520 нм с параллельными и перпендикулярными поляризаторами в линию. Фоновую флуоресценцию в лунках, содержащих только буфер, вычитали из всех значений, полученных для образцов. Данные поляризации анализировали с использованием GraphPad Prism 5.0 путем нелинейной аппроксимации с моделью общего связывания на одном сайте. Все данные представляют собой среднее значение по крайней мере трех отдельных экспериментов, а шкала ошибок составляет 1 с.d. Пептидные последовательности представляют собой последовательности, изображенные на фиг. 1а, в каждом случае им дополнительно предшествуют флуорофор и линкер из четырех аминокислот (Flu-GGYG). Для конкурентных анализов 1 мкМ KuΔC инкубировали с 2,1 мкМ флуоресцентно меченными пептидами WRN-nA, WRN-cAX или MRI-A в течение 10 мин при комнатной температуре, после чего следовала указанная концентрация немеченого пептида APLF (наивысшая концентрация; 29 мкМ).

Лазерное микрооблучение

2 × 10 5 клеток U2-OS или Ku80 — / — эмбриональных фибробластов мыши 40 высевали в чашки со стеклянным дном 35 мм (Mattek) в DMEM (+ 10% FCS) и через 2 дня трансфицировали либо (клетки U2-OS) 1 мкг плазмидной ДНК и 3 мкл Genejuice (Merck Millipore), либо ( Ku80 — / — эмбриональных фибробластов мыши) 7.5 мкл GeneJuice и 0,5 мкг указанной плазмиды GFP-KBM, 1 мкг pmRFP-Ku70 и 1 мкг вектора pmRFP-C1, pmRFP-Ku80 или pmRFP-Ku80 L68R . Через 24 часа после трансфекции клетки предварительно обрабатывали 10 мкг мл -1 Hoechst 34580 (Sigma) и подвергали микрооблучению (210 нДж мкм -2 ) лазером 405 нм, сфокусированным через масляный объектив × 60 (Intelligent Imaging Innovations). Изображения были получены с интервалом в 10 секунд после обработки, а анализ изображений проводился с использованием программного обеспечения Slidebook.

GFP pull-down анализы

Клетки HEK293T культивировали в среде DMEM с добавлением 10% FCS, глутамина и антибиотиков в 15-сантиметровых культуральных чашках, и при ∼70% слияния среду заменяли на 18 мл среды Hybridoma-SFM (с добавлением 1 % FCS и антибиотиков) и дополнен 2 мл смеси для трансфекции, содержащей PEI (80 мкг) и соответствующую плазмиду (20 мкг). Клетки собирали через 48 часов, промывали холодным PBS и быстро замораживали. Размороженные осадки (5 × 10 6 клеток) лизировали в 400 мкл буфера для лизиса (25 мМ Трис-HCl, pH 7.5, 150 мМ NaCl, 10% глицерина, 0,5% Triton X-100, 1 мМ DTT), содержащий ингибиторы протеаз и фосфатаз (Sigma), в течение 20 мин при 4 ° C. Образцы обрабатывали ультразвуком в ультразвуковом аппарате с водяной баней в течение 10 минут с 30-секундными интервалами (30 секунд включения / 30 секунд выключения). Экстракты клеток осветляли центрифугированием (13000 g , 10 мин, 4 ° C) и 40 мкл удаляли для «входящего» образца. Гранулы GFP-TRAP (20 мкл; Chromotek) трижды промывали буфером для лизиса, затем инкубировали с супернатантом в течение 1 ч при 4 ° C. Несвязанные белки выделяли осторожным центрифугированием (2700 g , 2 мин, 4 ° C), и шарики промывали 3 × 500 мкл буфера для лизиса.Затем белки элюировали с шариков с использованием загрузочного буфера SDS-PAGE, нагревали при 95 ° C в течение 5 минут, аликвоты фракционировали с помощью 10% SDS-PAGE и переносили на мембрану Hybond-C (GE Healthcare). Белки были обнаружены с помощью иммуноблоттинга с использованием анти-GFP (Cell Signaling # 2555S, разведение 1/1000), анти-Ku80 (Abcam Ab80592, разведение 1/10 000), анти-ДНК-PKcs (Abcam Ab80514, разведение 1/1000) или анти-RFP. (Abcam, Ab62341, 1: 1000) антитела. Фотографии полных мембран, содержащих блотированные элюаты из этих экспериментов, показаны на дополнительных рисунках 6–8.

Strep-tag pull-down анализы

Гранулы Streptavidin Mag Sepharose (100 мкл; GE Healthcare) трижды промывали буфером для образцов (20 мМ Hepes pH 7,5, 150 мМ NaCl, 5% глицерин, 0,5 мМ TCEP, 0,05% IGEPAL-CA640), затем инкубировали с меченными Strep 50 нМ WRN, WRN ΔcAX или WRN W18G в течение 1 ч при 4 ° C. Несвязанный белок извлекали путем приложения магнитной силы к суспензии, и шарики промывали 3 × 500 мкл буфера для образцов. Рекомбинантный немеченый белок Ku (50 нМ) затем инкубировали с шариками в течение 1 ч при 4 ° C, несвязавшуюся фракцию удаляли и проводили промывки, как описано выше.Связанные белки элюировали с шариков с использованием загрузочного буфера SDS-PAGE, нагревали при 95 ° C в течение 5 минут, аликвоты фракционировали 10% SDS-PAGE и окрашивали Instant Blue (Expedeon).

Экзонуклеазные анализы

Меченный 5 ‘Cy3 олигонуклеотид длиной 30 п.н. (5’ cy3-CCGTTTCGCTCAAGTTAGTATGTCAAAGCA -3 ‘) отжигали с комплементарным немеченым олигонуклеотидом 30-п.н. дуплекс п.н. с 5’-выступами из 10 нуклеотидов. 20 нМ дуплекса ДНК инкубировали при 37 ° C в течение 30 мин с 10 нМ или указанным титрованием WRN-Exo или WRN-Exo W18G в реакционном буфере (20 мМ Tris-HCl, pH 7.5, 50 мМ KCl, 10 мМ MgCl 2 , 1 мМ DTT и 0,1 мг / мл -1 BSA). Где указано, реакции также содержали 10 нМ или указанное титрование Ku, Ku70 / Ku80ΔC или Ku70 / Ku80ΔC L68R и где указано 5 мМ либо MgCl 2 , либо MnCl 2 . Реакции останавливали, используя 90% (об. / Об.) Формамид / ТВЭ, и нагревали при 95 ° C в течение 5 минут. Продукты фракционировали на 16% гелях ТВЕ-мочевина в 1 × ТВЕ (89 мМ Трис, 89 мМ борная кислота, 2 мМ ЭДТА) и отображали на устройстве для визуализации изображений Fuji с использованием фильтра Cy3.

Анализ γh3Ax

3 × 10 5 указанных клеток были засеяны и выращены на покровных стеклах в чашках диаметром 35 мм и выращены до слияния в течение 1 недели. Затем клетки обрабатывали 2 Гр γIR, фиксировали параформальдегидом в указанные моменты времени и помечали иммуномеченым, как описано ранее 41 . Клетки были помечены CENPF для подтверждения того, что клеточные популяции были заблокированы слияния.

KR KBM Ставки — ХОРОШИЕ + Заблуждения о старых и новых системах Sugo: OnePieceTC

Корейский сервер на один день опережает глобальный сервер и завершил техническое обслуживание сервера сегодня, и их Kaido vs BM Sugo ЖИВЕТ.В результате наш дружелюбный модуль / u / CubeoHS предоставил мне сводную информацию о рейтингах серверов KR для баннера. Следующий анализ основан на коэффициентах KR — эти коэффициенты необходимо проверить с помощью глобального сервера, поэтому имейте в виду, что

Имейте в виду, что базовая скорость KBM составляет 0,233% , что кажется НАМНОГО ниже, чем базовая скорость новая система (обычно 0,5%)

Также имейте в виду, что нормализованных ставок корректируют с учетом скидок! Они представляют собой «стоимость потраченного драгоценного камня».

  • В результате того, что все красные multi перешли на multi 10 вместо 20, ставки для KBM на самом деле ВЫШЕ, чем у 2 самых любимых Sugos в истории Global OPTC

  • Устаревший система Суго означает плохие дебютные ставки? НЕТ! Это означает плохие показатели BASE , но если шаги достаточно хороши (в большинстве случаев это , конечно, здесь), то это повысит общие показатели на ЛОТ

  • Какой шок! Фактически, дебютные ставки KBM не уступают дебютам новой системы!

  • Да, ставки составляют дерьмо в мультис 1-4, но в тот момент, когда вы нажимаете мульти 5 и выше, их ставки конкурируют с дебютом новой системы

  • На самом деле ставки ВЫШЕ, чем у Роджера и Одена. ставки на Новый год!

  • У KBM Sugo есть ОДИН недостаток, и это факт, что гарантия составляет 1500 драгоценных камней по сравнению с другими дебютами на Global, у которых гарантия была намного раньше.В результате средняя стоимость драгоценных камней немного снижается, но она не очень значительна

  • Роджер Оден в Нью-Йорке в среднем 510 драгоценных камней (гарантия 1057 драгоценных камней)

  • КБМ в среднем 547,5 драгоценных камней (гарантия 1500 драгоценных камней)

  • JP Ace vs Akainu в среднем составляет 635 драгоценных камней (гарантия — 1500 драгоценных камней, таких как этот Global)

  • Анализ Anni Sugo за последний месяц. Эй, не то чтобы я не называл их САМЫМИ ЛУЧШИМИ ставками, которые мы когда-либо видели, или что-то в этом роде, а? Они вдвое лучше любого знамени в истории.Тем не менее, огромное количество пропусков EZ я видел …

  • В любом случае очевидно, что ставки не будут такими высокими, как баннер Anni. Мол, дебют Anni в среднем стоит 300 драгоценных камней. Мы хорошо зарабатываем 300-400 + драгоценных камней в месяц F2P. Если каждая легенда будет в среднем НИЖЕ нашего дохода от драгоценных камней, как Bandai когда-нибудь сможет зарабатывать деньги?

  • Обратите внимание, что дебютные пики KBM несколько раз достигают 0,968% -0,973%, в основном колеблясь на уровне около 0,9%, снижаясь до менее 0.8% в хвостовой части. Я буду использовать 0,9% для простоты анализа ниже

  • Рейтинговые легенды с повышенным рейтингом колеблются около 0,7% <- для простоты я просто сгруппирую их вместе

  • Легенды без рейтинга колеблются около 0,3% <- для простоты я просто сгруппирую их вместе

Старая система против новой

Я видел МНОГО людей, утверждающих, что новая система лучше, потому что базовых ставок лучше, или потому что пулов лучше. ограничено , или потому что дает скидку .Или что старая система лучше только для новых плееров . Так ли это на самом деле? Из десятков игроков, высказывающих свое мнение об этом субреддите, я не думаю, что видел , чтобы один игрок действительно выполнял математические вычисления . Все комментарии основаны на инстинкте или на том, как они себя чувствуют, , но не обязательно на том, что отражается в реальности . Теперь старые системные баннеры сильно зависят от шагов, поэтому разница между баннерами очень велика, но, по крайней мере, для этого конкретного старого системного баннера это математика, так что вам не нужно это делать

Базовые ставки НЕЛЬЗЯ сравнивать

Я видел ТАК много людей, утверждающих, что из-за того, что базовые ставки ниже в старой системе, ставки в целом хуже.Ты. НЕ МОЖЕТ . Сравнивать. Ставки. Нравиться. Что. Вы должны скорректировать вероятности, чтобы учесть шаги и скидки, что и делает , нормализующий . Чтобы проиллюстрировать преувеличенным примером:

  • Предположим, что на баннере A базовые ставки равны 1%. Нет ступенек (вроде бесплодных шагов Суго, таких как Роджер Оден)

  • Предположим, на баннере B базовые ставки равны 0% , но +1 на каждом множителе составляет 20%

  • У какого баннера выше ставки? Вы не можете просто сказать, поскольку 0% <1%, что баннер A имеет более высокие показатели. Потому что баннер B имеет объективно более высокие рейтинги

Но это не только преувеличение, это верно и для НАСТОЯЩИХ баннеров! Посмотрите на графики, которые я разместил выше.

  • KBM имеет базовые ставки 0,233%, но ТОННА шагов

  • Roger / Oden имеет базовые ставки 0,6%, но почти НЕТ шагов

  • Ace vs Akainu имеет базовые ставки 0,5%, но SHIT шаги

  • У какого баннера более высокий рейтинг? Кайдо Биг Мам делает , несмотря на то, что у него самые низкие базовые ставки.

Насколько велико влияние шаги?

Давайте рассмотрим баннер Роджера / Одена в Нью-Йорке. Практически не было шагов, за исключением мульти-кристалла с 1 драгоценным камнем и очень небольшого количества гарантированных красных, самое раннее на мульти 6. Для аргументации давайте посмотрим на 302 потраченных драгоценных камня, 8 мультисайтов. Давайте рассмотрим два мультисайта по 1 драгоценному камню как «шаги». а также +1 на 6-м мульти.

  • Таким образом, мы сделали в общей сложности 6×11-1 = 65 «обычных оттяжек» по 0,6% каждое. Это дает примерно 32.4% -ный шанс вытащить Роджера, приписанный «базовым ставкам»

  • Мы также сделали 2×11 = 22 «шаговых» тяги по 0,6% каждое, а также +1 шаг при 4%. Это дает примерно 15,9% шанс вытащить Роджера, отнесенного к «ступеням»

  • Итак, примерно 2: 1 разделение с точки зрения «весов» базовой ставки по сравнению с шагами для Роджера Одена Суго (и это с учетом 1 gem multis как «шаги»)

Давайте рассмотрим баннер Ace vs Akainu на JP.Sugo megathread для тех, кто не знает. Единственным «настоящим» шагом было несколько 10. Итак, давайте предположим, что в этом случае было потрачено колоссальные 500 драгоценных камней.

  • Итак, мы сделали в общей сложности 10×11 — 4 = 106 «обычных оттягиваний» по 0,5% каждое. Дает примерно 41,2% шанс вытащить туза против Акаину в 10 мультисоставах, связанных с «базовыми ставками»

  • Мы также провели 2 пулла по 4,166% каждая, 1 при 6% и 1 при 10%. Дает примерно 22,3% шанса натянуть Ace vs Akainu за 10 мультисистем, отнесенных к шагам

  • Опять же, близкое к соотношению 2: 1 с точки зрения базовых ставок по сравнению с шагами.

Посмотрим на КБМ. КАЖДЫЙ мульти имеет ступеньку. Сделаем 6 мульти (300 гемов).

  • Мы сделали 5х10 = 50 «нормальных оттяжек» по 0,233% каждое. Это дает примерно 11% вероятность получения KBM, приписываемого «базовым ставкам».

  • Мы сделали 2 вытягивания с 1% для мультисистемы 1 + 4, 1 вытягивание с 1,667% для мульти 2, 12 операций с 2,231% для мультисистемы. 3 и 5, а также 1 вытягивание при 12,5% для multi 6. Это дает примерно 35,7% вероятности вытягивания KBM, приписываемой ступеням. скорости в сравнении с шагами

Это полная противоположность! Старые системные суго НЕ прозрачны для .Вы должны ДЕЙСТВИТЕЛЬНО копаться в шагах, чтобы понять, что происходит. Но это не обязательно означает, что ставки ХУЖЕ. У ступеней есть большинство ставок. Игнорировать их и ТОЛЬКО сравнивать базовые ставки — это полностью ложное и вводящее в заблуждение

Итак … как же тогда сравнивать старую систему с новой?

Перво-наперво, давайте установим несколько простых показателей для сравнения.

  • French Anni достигла пика 0,776% при multi 5 и колебалась около 0.65% впоследствии

  • Super Typing достиг пика на уровне 1% при multi 5 и впоследствии колебался около 0,88%

  • У сахара / курильщика было несколько пиков, все около 0,915% -0,941%, колеблясь около 0,85% в середине

  • Roger / Oden достиг пика 0,812% при multi 8, колеблясь около 0,75% в середине

  • HW Mihawk / Law имел несколько пиков между 1,039% -1,075% и обычно колебался около 1%

  • Anni Часть 1 достигло 1.235% и колеблется около 1,15%

  • Anni Part 2 достигла пика 1,642% и колебалась около 1,5%

  • Anni Part 3 достигла пика 1,768% и колебалась около 1,6%

  • Разбивка баннера KBM с использованием закругленных числа для простоты (, потому что вам нужно посмотреть, как рейтинг с повышением и без рейтинга влияет на баннер ):

  • КБМ дебют около 0,9% (близко к показателям дебюта новой системы)

  • Рейтинг около 0.7% (несколько близко к показателям новой системы)

  • Без рейтинга повысился примерно на 0,3%

Давайте развеем миф. Имейте в виду, что эта «старая система» отражает только ТЕКУЩЕЕ KBM Sugo. Старая система Sugos очень изменчива из-за зависимости от шагов, поэтому при сравнении баннер изменится на баннер

  • Кит, который ТОЛЬКО пропускает новый дебют, предпочтет систему NEW . Но это не потому, что ставки ЛУЧШЕ, а потому, что новая система Sugos обычно давала более дешевые гарантии, чем 1500 драгоценных камней.Потому что, как видно выше, дебютные ставки KBM во многом сопоставимы с дебютами новых систем. Тем не менее, дебюты новой системы ТАКЖЕ могут иметь гарантии на 1500 драгоценных камней. Мы видели это снова и снова на JP с Зоро / Кайдо, Эйс против Акаину, BB / Мория.

  • Кит, который НЕ УКАЗЫВАЕТ ТОЛЬКО ДВУХ легенд, одна из которых является дебютной, предпочтет OLD . Почему? Дебют новой системы колеблется от 0,8% до 1%. Дебют КБМ составил 0,9%. Добавьте ОДНУ другую недостающую легенду, и вы получите более высокие ставки на баннере KBM, чем на новом системном баннере, где вы пропустите только 1 легенду.И если вы кит, которому не хватает только двух, скорее всего, вы не пропустите 2 на новом системном баннере.

  • МИФ — На самом деле вам НЕ нужно быть «новым игроком», которому не хватает множества легенд, чтобы старый добрый системный баннер был ЛУЧШЕ, чем новый системный баннер. Киты, которым не хватает ТОЛЬКО ДВУХ легенд, будут иметь здесь лучшие ставки, чем на новом системном баннере. Киты, которым не хватает ТОЛЬКО ОДНОГО, предпочтут новый системный баннер.

Но я не кит, как мне сравнивать баннеры?

Проиллюстрируем на примере.

  • So / u / CubeoHS отсутствует 2 оцененных единицы (один — KBM) на этом баннере и 3 единицы без рейтинга (итого 5 отсутствующих легенд). Тогда приблизительно их общая частота составляет 0,9% + 0,7% + 0,3% x 3 = 2,5%

  • По сравнению с баннерами новой системы, где частота составляет от 0,8% до 1%, это то же самое, что и , где отсутствуют 2,5–3 единицы. новый системный баннер . Это хорошо для тебя? Вы должны будете судить об этом на собственном опыте. Как часто вы видели новые системные баннеры, в которых отсутствует более трех? В опыте / u / CubeoHS он обычно видит 1 недостающую легенду на баннере, иногда 2.Что это значит? Это баннер GOOD , который можно использовать по сравнению с другими баннерами новой системы.

  • По сравнению с баннерами Anni, где процент от 1,2% до 1,6%, это то же самое, что , в баннере Anni не хватает 1,5–2 единиц. Надо добавить, что баннеры Anni обыграть ОЧЕНЬ сложно. Это не должно быть метрикой, по которой вы судите, хороший баннер или нет.

Давайте попробуем другой пример. Однако этот полностью выдуманный, поэтому я не уверен, насколько он реалистичен.

  • Предположим, вы игрок, которому не хватает 20 легенд. Однако это отражает игрока, который делает сейв только для крупных игроков. 1 дебютный, 4 с повышенным рейтингом и 15 без рейтинга. Общий рейтинг составляет примерно 0,9% + 0,7% x 4 + 0,3% x 15 = 8,2%

  • По сравнению с обычными баннерами новой системы, это то же самое, что и отсутствие 8-10 легенд на баннере новой системы (очевидно, действительно хорошо несмотря ни на что)

  • По сравнению с Anni, это то же самое, что и отсутствие 5-7 Legends на Anni.Если вы пропустили более 5-7 на Anni и пропустили это для этого, то, возможно, вы не будете очень счастливы.

И последнее, скажем, для ДРУГОГО баннера старой системы, чем у KBM, если они будут делать больше в будущем.

  • Предположим, что этот новый баннер имеет нормализованные ставки 0,5% для дебюта, 0,3% для рейтинга с повышенным рейтингом и 0,1% для без рейтинга

  • Предположим, вам не хватает 1 дебюта, 1 с повышенным рейтингом и 2 без рейтинга. Это всего 1%

  • , что эквивалентно отсутствию более 1 легенды на новом системном баннере.Это хорошо? Ну … конечно, нет, поэтому в этом случае вы предпочтете НОВУЮ систему СТАРОЙ системе.

Подводя итог, практические оценки:

Процедура:

  1. Найдите свою общую оценку:

0,9% + Количество пропущенных рейтинговых легенд x 0,7% + Количество отсутствуют легенды без рейтинга x 0,3% = общая оценка

2. Для сравнения с новым системным баннером разделите общую оценку на 0.8% и 1%, чтобы определить диапазон.

Нижняя граница = Общая ставка / 1%

Верхняя граница = Общая ставка / 0,8%

3. Этот диапазон относится к количеству отсутствующих легенд на новом системном баннере. Например, у / u / CubeoHS было 2,5-3. Обычно он видит 1-2 на новом системном баннере. Так что отсутствие 2,5-3 — это очень хорошо. Этот баннер хороший или плохой? Вам нужно будет судить, основываясь на вашем историческом опыте.

Maiello Brungo & Maiello (MBM Law) Фирма в Пенсильвании

ВЕДУЩАЯ ЮРИДИЧЕСКАЯ ФИРМА, БЛАГОДАРЯ ПЕНСИЛЬВАНИИ

В адвокатском бюро Maiello Brungo & Maiello (MBM Law) мы с 1972 года предоставляем высококачественные юридические консультации семьям, предприятиям и отдельным лицам.
Юристы MBM Law со штаб-квартирой в Питтсбурге стремятся предоставлять исключительные юридические услуги каждому из наших клиентов и добиваться оптимальных результатов. Мы предлагаем исчерпывающие знания в широком спектре практических областей, начиная от сделок с недвижимостью и трудовых договоров до открытия бизнеса и планирования недвижимости.

Наша способность предоставлять такие выдающиеся юридические услуги начинается с нашего трудолюбивого персонала и нашей страсти к разрешению и предотвращению юридических споров.Мы считаем своим приоритетом тесное сотрудничество и постоянное общение с нашими клиентами, чтобы получить полное представление о желаемых результатах. Чтобы предоставить лучший совет, наши юристы работают совместно друг с другом, чтобы разработать хорошо информированную стратегию для каждого случая. Это гарантирует, что каждый юридический вопрос будет оцениваться с разных точек зрения, что решения будут практичными и своевременными, и что наши клиенты выиграют от благоприятных результатов.

В Maiello Brungo & Maiello наша квалифицированная команда юристов считает привилегией обслуживать широкий спектр клиентов, включая государственные агентства, малые предприятия и местных жителей.Кроме того, мы гордимся тем, что поддерживаем долгосрочные отношения со многими нашими клиентами и работаем с ними на протяжении многих лет для решения любых возникающих проблем. Тем не менее, мы всегда рады работать с новыми клиентами и открывать новые возможности. Мы рады проконсультировать физических лиц по юридическим вопросам в следующих областях практики:

В Maiello Brungo & Maiello наша юридическая фирма специализируется на предоставлении специализированных юридических консультаций и услуг для юридических и физических лиц.

Добавить комментарий

Ваш адрес email не будет опубликован.